PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004500961.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family MIKC_MADS
Protein Properties Length: 230aa    MW: 26585.3 Da    PI: 9.6173
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004500961.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.87.7e-30959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien++nrqvt+skRrng++KKA+EL vLCda+v++i+fsstgkl+ey+s
  XP_004500961.1  9 KRIENTTNRQVTYSKRRNGLFKKANELTVLCDAKVSIIMFSSTGKLHEYIS 59
                    79***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.8E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.408161IPR002100Transcription factor, MADS-box
CDDcd002654.95E-38280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.66E-36395IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-29323IPR002100Transcription factor, MADS-box
PfamPF003191.6E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004044.5E-293859IPR002100Transcription factor, MADS-box
PfamPF014862.8E-1882167IPR002487Transcription factor, K-box
PROSITE profilePS5129714.27384174IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MARGKIQIKR IENTTNRQVT YSKRRNGLFK KANELTVLCD AKVSIIMFSS TGKLHEYISP  60
SISSKQFFDL YQMTVGTDLW TSHYENMQEH LKKLKDVNRN LRKEIRQRMG DCLNDLSMEE  120
LRLLEEEMDK AVKVIREKKY KGITSQIDTH RKKFNNEREV HNRLLHDLDA RGEDPRYELM  180
DKGGEYESVI GFSNLGPRMF ALTLQPTHPN AHSGGAGASA SDLTTYPLLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-15162162Myocyte-specific enhancer factor 2B
1tqe_Q4e-15162162Myocyte-specific enhancer factor 2B
1tqe_R4e-15162162Myocyte-specific enhancer factor 2B
1tqe_S4e-15162162Myocyte-specific enhancer factor 2B
3mu6_A4e-15362261Myocyte-specific enhancer factor 2A
3mu6_B4e-15362261Myocyte-specific enhancer factor 2A
3mu6_C4e-15362261Myocyte-specific enhancer factor 2A
3mu6_D4e-15362261Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00077ChIP-seqTransfer from AT3G54340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN4120960.0JN412096.1 Medicago truncatula MADS-box transcription factor NMH7 (NMH7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004500961.11e-174PREDICTED: floral homeotic protein DEFICIENS
SwissprotP237061e-107DEFA_ANTMA; Floral homeotic protein DEFICIENS
TrEMBLG7J4N11e-154G7J4N1_MEDTR; MADS-box transcription factor
STRINGGLYMA06G02990.11e-149(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27353375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.12e-83MIKC_MADS family protein